PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13982.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 562aa    MW: 61957.3 Da    PI: 8.4826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13982.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88.1e-1663109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
       KHN13982.1  63 KGGWTAQEDETLRNAVAVFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 109
                      688*****************************.************986 PP

2Myb_DNA-binding62.67.8e-20115161148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v ++G+  W++Ia+ ++ gR +kqc++rw+++l
       KHN13982.1 115 KGPWTQEEDDKIVELVSKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 161
                      79******************************.*************97 PP

3Myb_DNA-binding50.16.4e-16167210146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ +  gRt++ +k++w++
       KHN13982.1 167 KDAWTLEEELSLMNAHRIHGNK-WAEIAKVLH-GRTDNAIKNHWNS 210
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.72858109IPR017930Myb domain
SuperFamilySSF466891.87E-1460116IPR009057Homeodomain-like
SMARTSM007171.5E-1362111IPR001005SANT/Myb domain
PfamPF002492.6E-1463109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2065116IPR009057Homeodomain-like
CDDcd001673.76E-1266109No hitNo description
PROSITE profilePS5129433.151110165IPR017930Myb domain
SuperFamilySSF466893.26E-31112208IPR009057Homeodomain-like
SMARTSM007171.9E-18114163IPR001005SANT/Myb domain
PfamPF002496.7E-19115161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-28117164IPR009057Homeodomain-like
CDDcd001672.18E-16117161No hitNo description
Gene3DG3DSA:1.10.10.603.1E-22165216IPR009057Homeodomain-like
SMARTSM007177.3E-14166214IPR001005SANT/Myb domain
PROSITE profilePS5129420.403166216IPR017930Myb domain
PfamPF002493.5E-14167210IPR001005SANT/Myb domain
CDDcd001671.16E-10169212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MKDMAEVVKS EECCQENKQS TAASCSSVSE GSGSAIHKSP AICSPASTSP SHRRTTGPIR  60
RAKGGWTAQE DETLRNAVAV FKGKSWKKIA EFFPDRSEVQ CLHRWQKVLN PELVKGPWTQ  120
EEDDKIVELV SKYGPTKWSL IAKSLPGRIG KQCRERWHNH LNPDIKKDAW TLEEELSLMN  180
AHRIHGNKWA EIAKVLHGRT DNAIKNHWNS SLKKKLDFYL ATGRLPPIPK NSPQVPVKDT  240
IRRSASKSIL GCSNKELNAA VETSSETTSI SKLDDRGRNQ FESSGTVREV GDCSSVPANE  300
SADSDCVECK PGSSNIDLSC SNSEQLSRAN FGTTFGLISE NSGINGNSNF EHCTNNGDMS  360
STRLIGTSSQ ESPTCGSLCY EPPQLDGSVP IDSLYLNYIC QQNEYCPSPT MSPIGFFTPP  420
RVKGSQLCTE TPESILKKAA NTFPNTPSIL RRRKTGAQTL TSPSKVLKVD NNPHTSKTER  480
TDDDSGSGHF SRSPASHGNG IDIPNNKAFN ASPPYRLRSK RTAIVKSVEK QLEFAFDKEK  540
NDDKRSNVMT EDRLHETKLV VT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-67622165159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-67622165159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602590.10.0PREDICTED: myb-like protein A
TrEMBLA0A0B2Q2F20.0A0A0B2Q2F2_GLYSO; Myb-related protein 3R-1
TrEMBLI1N2H10.0I1N2H1_SOYBN; Uncharacterized protein
STRINGGLYMA18G39740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-145myb domain protein 3r-5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]